SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365707|ref|YP_001657980.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365707|ref|YP_001657980.1|
Domain Number 1 Region: 370-425,509-744,778-807,883-968
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.97e-73
Family Myeloperoxidase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 1081-1250
Classification Level Classification E-value
Superfamily beta-Roll 2.81e-30
Family Serralysin-like metalloprotease, C-terminal domain 0.0004
Further Details:      
 
Weak hits

Sequence:  gi|166365707|ref|YP_001657980.1|
Domain Number - Region: 215-272
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00847
Family Myeloperoxidase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166365707|ref|YP_001657980.1|
Sequence length 1289
Comment hypothetical protein MAE_29660 [Microcystis aeruginosa NIES-843]
Sequence
MPNPNFDSVIDTFTIDDLFFLRYQYRVYKEWNNDPRLAVLPGFSPGVTGARATSGIRFVD
GTDQLRYQVGGGITPISAPYPLSTTDPKFMAGATGTLFRRLTSQSFTQATGGFTINFQTG
AVVYDQNYTLDYSLRGSANPSNPHIFDASPRLISNLVSNQSGKTALQVLDDPYAREWTQA
GTQAGKRVSQKNNTRHETILTGGNGVNGSNTGNPLPNSGFFALFGQYNDHGMDFLAKGKD
GSLLIPLLPGDSLYTPGSPTNFMALSRTNTVQVEIGEGSRDALVAELGLAGYSRPSQWDV
DNENAAIGTSFTGTSGGTLVLNEQLIVISAGATLNDIVTTINSKAAFTGVVASTTTNGSS
QSVLKLTPRNGESFNQTSAFFDLNQVYGSVESHAIFMREYKGNGELTGRLLADPQNSTAR
WFDLKKNAERIGLTLRDRDVLSVPLVEIIPQGQPNAGRYAFVVLDKVSGQKSYVFDTADV
TSNQVLAKAGSAFLIDLARDWKGSPQPAGSDPFKANGDLKDPSRLNEHAVGGDGRLNENI
GLTAMHEIFVTTHNNILSQIEANLAQNAGNNGNNQALSGQELFEMAKLANENFYQHHVLQ
EYARRITPNLGAFAGANAGNNNNAGFNASILAEFASSAFRFGHSQLTETVALTSVNQQTG
LANPGGQMDIPLLQAFLAPQIYTRHTAGQIAAGMSQQVGNATDEFITNTLQNALVGLPLD
LGALNIARGLDTGITSLNEARRQIQTYLRDVRTSPGGTTGLVQANNAIDANLASLEANLR
PYISWKDFGAHLLHPESLKTFIMAYARDAILSGYSGNANLSYWNQLQASSAPGAAATYAA
ALSAAADLAMGDDAFMGLLYSGSSSDALNPSAPVNTPSGNQDFQNISLWLGGLAEAKTPG
GMLGPTHDFIYAYQMQQLQRGDETYYLSKLAATDLVEEIKGKTVADMVMAATGVKHLYHK
IFAVNDADYERSLQSFNTYSSEALLLGATQTVVDVTGTQRLVGRAGYVNGVLVGNGGNYL
DARGVFSPNGEGKASELFGGTNGSDQFKGLAGDDCMWGDGGADTFWAGDDNDFADGGEGH
DTIYGENGFDMLRGDAGNDQIYGGTGNDDMYGGEGNDSLFGEDGIDDLNGGNGNDLVSGG
LGNDQVKGQAGNDTLIGGQGNDIITGGGGNDLFTFNEAPGLNGVDQLRDFNSTLDKLVFD
KNVYAGLSGSTLTAAQLRAEAGATVATTASQRFIYNLSNGDLFFDPDGTGVLAVTQIANL
NRFNPAFPSDVASANAVFPNLVSSNFLLI
Download sequence
Identical sequences B0JKJ9
449447.MAE_29660 WP_012265968.1.4043 gi|166365707|ref|YP_001657980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]