SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365919|ref|YP_001658192.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365919|ref|YP_001658192.1|
Domain Number 1 Region: 24-433
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.27e-117
Family GABA-aminotransferase-like 0.000000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166365919|ref|YP_001658192.1|
Sequence length 462
Comment N-acetylornithine aminotransferase [Microcystis aeruginosa NIES-843]
Sequence
MSILELIEKRLEENFALHEQYLNPQMVRVLKTIGYDRHYVKAQGAYLFDNQGEKYLDLLS
GFGVFALGRNHPKIVQALQEVLTAALPNLVQLDASILAGLLAERLAAIAPPGLERVFFAN
SGTETVEAAIKFSRYATGRSQIVYCQGGYHGLTMGSLSATGDPHYREGFGPFVADFKEIP
FGDLAALEKALINQDVAAFITEPIQGHGVRIPEPNYLPAAAALCRRYGTLFVADEVQTGL
GRTGKIWAVEHWGVEPDILCVAKALSGGFVPVGAVLCRRWIFDRVFDRMDRSVVHGSTFG
KNNLAMAAGIATLQVIEEEKLVERSAVIGQQIIAELQPLVDQYECLQEVRGLGMMMALEF
AEPSSWSLKAAWKMLETANKGLFSQLIVVPLFTRHQILSQVSGHGMNIIKFIPPLTLSDE
DCRWLVTAVKDVVADAHRFPGAAWEFGKTLASQAIRQKTAQK
Download sequence
Identical sequences B0JLH6
gi|166365919|ref|YP_001658192.1| 449447.MAE_31780 WP_012266131.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]