SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166365941|ref|YP_001658214.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166365941|ref|YP_001658214.1|
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily L28p-like 2.16e-25
Family Ribosomal protein L28 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166365941|ref|YP_001658214.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Microcystis aeruginosa NIES-843]
Sequence
MSRVCTMTGKKANNAYAVSHSHRRTKKLQEANLQWKRVWWSEGNRWVKLRISTKAIKTIE
KKGLAVFAREVGLNLNLY
Download sequence
Identical sequences A0A0A1VZT3 A0A0K1RYI5 A0A139GKA8 A0A1E4QKH3 A0A1X9L2Y3 A0A2H6BTZ2 A8YKC9 B0JLJ8 I4FGF6 I4FQQ6 I4HQQ4 I4HXI1 I4IM03 L7EBN9 S3IYQ7
gi|166365941|ref|YP_001658214.1| WP_002732080.1.10452 WP_002732080.1.13945 WP_002732080.1.15998 WP_002732080.1.23084 WP_002732080.1.24258 WP_002732080.1.39664 WP_002732080.1.4043 WP_002732080.1.42333 WP_002732080.1.43950 WP_002732080.1.43975 WP_002732080.1.50331 WP_002732080.1.50673 WP_002732080.1.52201 WP_002732080.1.5315 WP_002732080.1.62741 WP_002732080.1.86711 WP_002732080.1.88161 WP_002732080.1.98808 449447.MAE_32000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]