SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366228|ref|YP_001658501.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366228|ref|YP_001658501.1|
Domain Number 1 Region: 11-380
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.61e-71
Family TK-like PP module 0.023
Further Details:      
 
Domain Number 2 Region: 387-601
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.77e-21
Family TK-like Pyr module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166366228|ref|YP_001658501.1|
Sequence length 806
Comment putative phosphoketolase [Microcystis aeruginosa NIES-843]
Sequence
MVFTPERPLTEQNPLSQDELYKTHAYWRACNYLAVGMIYLRDNPLLKEHLKPEHVKYRLL
GHWGASPALSFTYVHLNRLIKKYDLDMIFMAGPGHGAPGVLGPVYLEGTYSEIYPDKSED
EEGLQKFFKQFSFPGHIGSHVTPETPGSIHEGGELGYSVSHAYGSVFDNPDLITAVVVGD
GEAETGPLATAWHSNKFLNPIRDGAVLPILNLNGYKIANPTILSRISTHELESLFVGYGY
TPYIVECKEDEDLMHCHQKMAATLEHCINQIRSYQQEARSTGVAKRYPWPMIILRSPKGW
TGPKNVDGHKVEGFWRAHQVPMGAMQENPEHLRKLEEWMKSYNPEELFDYTTGKFKPEFK
ELAPRGHRRMSANPHANGGLLRKDLKMPDFRQYAVDVTHPGQVEAENTGVMGVFLRDVMR
NNMTNFRVFGPDETASNRLAALYEVTKKAWLADTYPEDLDGSQLSPDGRVMEMLSEHTLV
GWLEGYLLSGRHGLFHSYEAFAHVIDSMFNQHAKWLDICKNHVPWRASVSSWNLLLSSVV
WRQDHNGFSHQDPGFIDLVTNKSADVVRVYLPPDGNCLLSVANHCLKSKDYTNIIVADKQ
KHLQYLTIEEAIKHCTKGIGIWDWASNDDDGTNPDEPDVIMACCGDIITKESLAATAILR
EEFPYLKVRFINVVDLFKLQSESEHPHGLSERDFDSLFTTDKPIIFNFHGYPWLIHKLTY
RRSNQERIHVRGYKEEGNINTPLELAIRNQVDRFHLVIDVIDRVPKLGSAAGHVKERMKN
AIIDNLDYAFTNGIDKDEITNWKWPY
Download sequence
Identical sequences B0JMM4
gi|166366228|ref|YP_001658501.1| WP_012266358.1.4043 449447.MAE_34870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]