SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366343|ref|YP_001658616.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366343|ref|YP_001658616.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.1e-57
Family Tryptophan biosynthesis enzymes 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366343|ref|YP_001658616.1|
Sequence length 212
Comment N-(5'-phosphoribosyl)anthranilate isomerase [Microcystis aeruginosa NIES-843]
Sequence
MRIKICGITQPDQGRAIATCGATALGFILVPSSPRYVKIEQINAITAAIPDKIDFIGVFA
DEQPEIIQQIIVKTPLTSVQLHGKESPEYCQRLRQLLPDREIIKALRIKDRESWEKSAIY
FNSVDTLLLDAYHPQLLGGTGHTLDWQALASFSPPLPWFLAGGLNPDNISEALTRLHPQG
IDVSSGVERSPGDKDLKKVALLLERLQKFRDQ
Download sequence
Identical sequences B0JNJ4 I4HYW5
WP_002798255.1.4043 WP_002798255.1.50331 449447.MAE_36020 gi|166366343|ref|YP_001658616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]