SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366413|ref|YP_001658686.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366413|ref|YP_001658686.1|
Domain Number 1 Region: 167-236
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000549
Family Peptidoglycan binding domain, PGBD 0.01
Further Details:      
 
Domain Number 2 Region: 243-410
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000000000000377
Family N-acetylmuramoyl-L-alanine amidase-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366413|ref|YP_001658686.1|
Sequence length 417
Comment hypothetical protein MAE_36720 [Microcystis aeruginosa NIES-843]
Sequence
MSWQDFIKAVERADFEFEWQRPLIIAQSILESGRGTTDLSRYKNMNGMKYRKSIAVPGAE
KFWYKTDSEPDPPGGDWFFKFDTYETGIDVWKKFYFRKDEDWIPYPKVYERDPKILKDAR
SFLSYIGPIYCPYFEDSHDVSYADYIMNRCYPEAQKLLREIGGDKFMLLQVGSQGLQVGQ
LQAKLNEIGFNCGRVDKIFGPKTKQAVENFQRDHLGESEVTGIVDERTWNQIMDHPSVRP
ASVLIDPGHSPIHSGTDAKDGTPEYEMNLLQAKIVKAELDKASISAEIFDPASDPRDLIG
QKAADHSMFLSLHHNATDRKPHYTCVMVHPTKAKPKSIAFAKKLSTSVANAIGQRDFGVM
ENGVTVLSESEDTNCPICVLCESYFLDAIDTRAEAEKLSTEAAYAIASTVIAELQPA
Download sequence
Identical sequences B0JNR4
gi|166366413|ref|YP_001658686.1| WP_012266488.1.4043 449447.MAE_36720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]