SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366493|ref|YP_001658766.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366493|ref|YP_001658766.1|
Domain Number 1 Region: 6-82,178-342
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.7e-47
Family Bacterial dinuclear zinc exopeptidases 0.0042
Further Details:      
 
Domain Number 2 Region: 72-186
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.0000000000000351
Family Aminopeptidase/glucanase lid domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366493|ref|YP_001658766.1|
Sequence length 344
Comment peptidase M42 [Microcystis aeruginosa NIES-843]
Sequence
MDFDHLFDTIATLVLHHSPSGMETEIDRFLLERFQELGLETWQDQAGNVIGKIRGRDSTK
KMAITGHKDEIGAIIKVINPDGTLQIRQLGGAFPWIYGEGVVDIIGDRETRSGILSFGSR
HISHQSPQKVQQENTPVTWESAWIETKLTPEELDACGVRVGSRVVVGKHRKQPLRLKDYI
ASYTLDNKASVAILLALAARVINPAVDIYLVASAKEEVGALGALFFTANNRLDALIALEI
CPLAPEYPIKDGSTPVLLSQDGYGIYDEELNQELRIAAEKAGIPLQLAIISGFGSDASIA
MKFGHIAKAACLGFPTQNTHGYEIAHLGAIANCISILEAYCQVI
Download sequence
Identical sequences B0JPK0
gi|166366493|ref|YP_001658766.1| WP_012266557.1.4043 449447.MAE_37520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]