SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366573|ref|YP_001658846.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366573|ref|YP_001658846.1|
Domain Number 1 Region: 4-199,300-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.2e-83
Family Bacterial dinuclear zinc exopeptidases 0.0000251
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.83e-28
Family Bacterial exopeptidase dimerisation domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366573|ref|YP_001658846.1|
Sequence length 393
Comment N-acyl-L-amino acid amidohydrolase [Microcystis aeruginosa NIES-843]
Sequence
MLSEIKNIAESLAPRLVEIRRHIHANPELSGQEYQTAAYIAGVLSSCGLSVQEAVGKTGV
KGELAGKGSDRRILAIRADMDALPIQERTDLDFASRKPGIMHACGHDVHATVGLGVAMVL
SRLSEPLQGKIRFLFQPAEEIAQGANWMIREGVMRDVSAVLGLHVFPSIPARSIGVRYGA
LTAAADDLEIFIQGESGHGARPHEAIDAIWIASQVITTLQQAISRTQNPLRPIVLTIGQI
SGGRAPNVIADQVRMAGTVRSLHPETHAHLPEWIESLVTNVCSTYNAKCQVKYRRGVPSV
QNDQFLTRLVEEAGLEAWGRDRVLILSEPSMGAEDFSLYLQQAPGTMFRLGVGSPHLLNP
PLHHPEFLVDESAILTGVITLAYAAYKYWQRQD
Download sequence
Identical sequences B0JPT0
gi|166366573|ref|YP_001658846.1| 449447.MAE_38320 WP_012266613.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]