SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366576|ref|YP_001658849.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366576|ref|YP_001658849.1|
Domain Number 1 Region: 5-229
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.93e-66
Family Decarboxylase 0.00000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366576|ref|YP_001658849.1|
Sequence length 233
Comment orotidine 5'-phosphate decarboxylase [Microcystis aeruginosa NIES-843]
Sequence
MTNSDRIIVPLDVPDLESAIALLDLLPEVNFWKVGLELFVSSGAEILGILQERQKKSFLD
LKFHDIPNTVAGACRSASRYQVDLLTLHATAGRQALTAAKGAISDLLSPPKLLAITVLTS
LNARELALDLKIPLELSEYALNLALLGKESGIDGAVCSPQEVAQLRRVCGEDFLLVCPGV
RPSWSSKGDQSRVMTPAQALKAGADYLVIGRPITGAEEPKVAWAKICQELADI
Download sequence
Identical sequences B0JPT3 I4HRM8
WP_002797036.1.4043 WP_002797036.1.50331 gi|166366576|ref|YP_001658849.1| 449447.MAE_38350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]