SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366602|ref|YP_001658875.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366602|ref|YP_001658875.1|
Domain Number 1 Region: 2402-2960
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.27e-131
Family Acetyl-CoA synthetase-like 0.000000254
Further Details:      
 
Domain Number 2 Region: 30-405
Classification Level Classification E-value
Superfamily Thiolase-like 8.94e-94
Family Thiolase-related 0.0022
Further Details:      
 
Domain Number 3 Region: 1541-1945
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.86e-86
Family GABA-aminotransferase-like 0.00000674
Further Details:      
 
Domain Number 4 Region: 558-686,749-842
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.7e-68
Family FabD-like 0.00062
Further Details:      
 
Domain Number 5 Region: 2168-2410
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.89e-52
Family NRPS condensation domain (amide synthase) 0.0091
Further Details:      
 
Domain Number 6 Region: 3220-3458
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.11e-48
Family NRPS condensation domain (amide synthase) 0.024
Further Details:      
 
Domain Number 7 Region: 3036-3213
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.22e-43
Family NRPS condensation domain (amide synthase) 0.013
Further Details:      
 
Domain Number 8 Region: 1987-2159
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.89e-35
Family NRPS condensation domain (amide synthase) 0.01
Further Details:      
 
Domain Number 9 Region: 1183-1364
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.41e-29
Family UbiE/COQ5-like 0.057
Further Details:      
 
Domain Number 10 Region: 2941-3015
Classification Level Classification E-value
Superfamily ACP-like 6.67e-16
Family Peptidyl carrier domain 0.00077
Further Details:      
 
Domain Number 11 Region: 936-1031
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000236
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 
Domain Number 12 Region: 684-747
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000000017
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366602|ref|YP_001658875.1|
Sequence length 3487
Comment McyE protein [Microcystis aeruginosa NIES-843]
Sequence
MVESIDYKKLMATTLSKMEVMQARINELETRQSEAIAVVGMACRFPGGINSPEKYWSFCQ
AGLDAIVEVPKSRWDISKLYSQEPTLGKMNTAYGGFLQENITEFDARFFSISAREAASMD
PQQRLLLEVAWEALENANLPLKNLADNKVGVFVGITSIDHALKVYGTNYDQIDSFFGTGN
ALSAAAGRLSYFLNLHGPCLSIDAACASSLVAVHQGIRSLRNRECELALVGGVNLILEPA
ITISLSQSGMMSPDGRCKTFDASANGYVRGEGCGVLILKTLSEAQKNGDHILALLRGSAV
NHNGAAAGLTVPSGPAQQELLRQALADARIVPEDVSYIEAHGTGTSLGDPIELNAIASVY
GKRSDPLYIASVKTNIGHLEAAAGMAGIIKTILILQQGEIPSHLHLQSPNPLINWEDHPI
KIPTQNIPWPNNNKVPIAGVSSFGFSGTNAHVIVQQAPVSKISEIQQQIPSHLLTLSAHN
KTALKELAKRFHTLLESHPEIGDICYSAAVGRIDLPERLAIVGDTCPELQQRLAAFAEEN
PLDDLTFYQRFTSEKSPKIVFLFTGQGACYPGMGHQLYQTQPTFRQYIDQCAEILAKYLD
HPLTEILFGEQTDLLNQTAYAQPAIFALEYSLTMLWKSWGITPSLLIGHSVGEYVAACIA
GVFSLEAGLALVVKRGQLMQTTTSGKMASIFADEETVISLIKNYTQTVSIAAINHPQQIV
IAGESASLEEVISTCKKQKIPAQYLPVTQAFHSPLMEPILKEFEKEARQISYQRPQILLL
SGLDGEVLENAPDATYWSKQCREPVRFLSSLITAFNKGYNLFLEVGPRPILAEQGRRYKD
EVIWLSSLNRGLDNWQTILSALGQLYLNGAPFNPEQFNRNYGYKKVRLPNYPFQRKPFQF
QPNPRTENQSIDKIFLDAQTSNLTDTETTVFNMQKHQQEIRNQLKSILALLLKEDENELP
EDETLLNLGADSIILTDFSRKIEEKFQVKVKIDQLFTDLQTLVDIAEYLCQFVKEKPLEN
ASEITAKVIDDETELSNYLQVIDQLQPIATAYIIKALESLGKKLNQGEQWTIETLRQTLP
VAPKYHILLNRYLQDLEQANILHNQGNIWTVKNLPESFSLPQALQKLEKTCPSAKPELEM
LQRCGENLAEVLKGNMDPLTLIFPEGSVAHAESIYGNSPVSRLMNQRVAQAINQILTNFS
NSDRPYQILEIGGGTGATSEAILHHLNLDHVTYSFSEVSPFLLHQARQKFQKKYNLNFHQ
LDIEKSPISQGIPAHNYHIVVAANVLHATRNITETLTHIRELLRPGGYLVLLETVENNSW
LNLTFGLTPGWWRFQDQELRSDTPLLRGENWCSVLKSCGFATANSFSKQNNIPINNGQEL
ILACVPDEPLSIPARTKLTVSGESSGKEALMMAQLQSLKDLKDLHEKTIIKQLEVLQTAT
VSPSIAPEILTNQTQIIPAQSSKIETYPPVSQEKPKSPEKPSSPNLNPLALKLTENKSLT
EQQQAFIQNLQSIYNQKTAKSKAYSQNSRKTMVDVKPTIDFRMALKEFQYPIVSESAQGA
YFKDIDGNNYIDLAMGFGVNFFGHSPDFVIEAVQEQMNRGIGLGMQSNLAAETAALISEM
GRVERVAFSNTGTEAIMAAVRIARSRTKRQKIVMFAGSYHGTFDGILARVGEDKTTAQPL
SLGTPLGMVEDVIVLSYGVEESLDIIATHADDLAAVLVEPVQSRKPDLQPQEFLQKLRQI
THKKGITLIFDEIITGFRIAPGGAQEWFNVEADIVIYGKAIGGGLPISMICGKADFLDTV
DGGFWQYGDDSHPQTELTAFGGTFCRHPLALAACRAVLLHLRENSPTIQEKVNQLTHRLA
TEVNQFFQEIGIPIRVVNFGSLFRFEPFGAYSIFLQPIELPLFYYLLNLKGIYTWEKRVC
FLSTCHTNEDIDKVIVAVKEAITELQQAGFFANAKRPQVKKEEKKPLSEDEDGRGHLPSL
NQSFPTSEAQRQLWLLAELDRNASASYNVTTSLELRGSLDVYILEKTINQVINRHEALRT
QIIEQGELQEVVNQVNIKLKLINLKDEDNPEATALALRSQFSQKPFDLSIAPLFAVILMR
LKPDHYLLSLKTHHIVADGWSLGLILQEIGQLYSSQNNTTKEVLTPPMQFRQYLTLRAQE
TQSPQMLEHRDFWLKTYQEDLPTFELPTDFPRPAVKTYTGGQESQVIPSEVGQNLQKVGR
KNKATLFMTMFAAYTAFLRRISGHKDLVIGIPISGRQIEGSDNLVGFCSQFLPLRIQVDA
TTSFIEHLQHTKQTLIDAFRHQSYTLEDLLAALQLPRDFSRSPLISVSFNMDPSLTLPEF
KDLKVSLPPSPISYTPFDLGFNLIELNDNLIIYCNYNTELFKKETIKQFLESFEILLRGI
IDDANHLLYQLPLLTPVQQEKLLRQLTGKTRKLPEKATIIDDFVAQVKLTPNAPALIAGK
ISLSYQELNEKVNRLTHYLQQEYQLGVGKVIGVMLQRNHNLIIGILATFKTGATYVPIDS
QYPHSRIEFILKDSGCHVCLTESNFISKLPEKMEKICLDKIDPIVEKYDKDEPKIFRDSS
QTAYIFYTSGSTGNPKGVMGRHISILNVIQSLRLTFDLDKHPEWRYIFTAAVTHDPSIRN
IFLPLTIGASLYMYEIKYIGHLVSFLQENQINALHTTPSIYREILGLLEPGETISSLKYI
SVGGEKLDRETALALRKRFPAEIISNVYGSTETCVGVSQYEIKENLDSEIPLGQVFHNNR
LGVLDEFNNPVPLHVIGEICVEGAALASGYHNQPEMTQEKFKPSFLDETKTLFRTGDLGK
QTAPGIIEFMGRKDNQVKVNGYRIDPGEIEYQLTRYAPIERAIVLPVQVNNQTQLSAYCQ
TDKTLEIAEIREFLAKFLPVYMIPSYFIFLKQFPLTRHGKLDLHSLRELKETSKSLVNSN
YVAPRNHLESNLVSIWEKILSKHPIGIFDNFFEIGGHSLLLSRVVTRVHKELNVSVKLAD
FFKVPTVAGLATLISQTQYNYQEPISAIPPQKSYPMSHGQRRLWALEFLDQNHNAYGMPS
AYQFKGNLNIDAFENAFQQLIQRHEILRTTFTLINNQPRQVVHNQMNFVIKQIDLTAYVS
TEQENLIEEAISHNAKTTFDLEVGPLLKVNLLKLSQENYIVLFNMHHIISDGWSAGVLIK
DFLSHYHAYGQENSQLMPPLRIHYKDYTSWQESQLETSKLQDQRDYWLAKLTPVPVRLNL
PVDYLRPPVKSFQGNTITWQPEPELIDTFEKLVKAQEASLFMGLVSLVKSFLFRYTEQNE
ITIGSAIAGRNHPDLEDQIGFYVNTLVLRDQIADHDSFTDVLSKVKTTTLEAYDNQDYPF
DQIVSDLNLQRDPSRNALFDVAIVLQNNQNIDLALNGITVNSIDPKMMTAKFDLEFIFVE
EEELYLKLIYNTDIFIHERILLLIDLFKNWLEQVLKFAHEPLINLSLASSENLIQEGQDL
FTEDFNF
Download sequence
Identical sequences B0JPV9 J9WPK4 J9WPL1
WP_012266631.1.4043 gi|166366602|ref|YP_001658875.1| 449447.MAE_38610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]