SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366604|ref|YP_001658877.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366604|ref|YP_001658877.1|
Domain Number 1 Region: 16-582
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.44e-94
Family Acetyl-CoA synthetase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 665-785,826-1051
Classification Level Classification E-value
Superfamily Thiolase-like 9.41e-79
Family Thiolase-related 0.00056
Further Details:      
 
Domain Number 3 Region: 1211-1339,1404-1506
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.45e-73
Family FabD-like 0.00017
Further Details:      
 
Domain Number 4 Region: 1800-2006
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.67e-37
Family Arylamine N-methyltransferase 0.082
Further Details:      
 
Domain Number 5 Region: 2230-2458
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.79e-36
Family Tyrosine-dependent oxidoreductases 0.00019
Further Details:      
 
Domain Number 6 Region: 2021-2218
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.33e-27
Family Tyrosine-dependent oxidoreductases 0.0063
Further Details:      
 
Domain Number 7 Region: 570-641
Classification Level Classification E-value
Superfamily ACP-like 1.83e-17
Family Peptidyl carrier domain 0.0039
Further Details:      
 
Domain Number 8 Region: 2512-2593
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000157
Family Acyl-carrier protein (ACP) 0.04
Further Details:      
 
Domain Number 9 Region: 1339-1403
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000000536
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366604|ref|YP_001658877.1|
Sequence length 2631
Comment McyG protein [Microcystis aeruginosa NIES-843]
Sequence
MSKHSISFGGQLEDNWRTLSEVLETATKHNNHGITYIKNDAAEYFQSYQDLYQDALVILN
GLEQKGIKLGHKVILQIAKNHDFIPALWACFLGGIIPVPLTVAPSYDLENSAVKKLENVW
KILDNPLILSDSELITEIEKLGTYSHLEGWQVISVNELRKAPSKVHQLPILDPQDPALLL
FTSGSTGMPKGVILTHHNILSMTAGTVAMNHFTQQEVTLNWMPLDHVGAIVFLGIMAVDL
ACHQIHVPMELVLRQPLQWLELIQKHQVSISWSPNFAFSLINQQAEELKHASYNLSSMKF
LVNAGEQVSVKTIRLFLEILEKHQLRERAIKPAFGMTESCSGITWSAGLSKNELTEENSF
VSLGKPIPGATIRIVDQENNPLPEREIGKLQIQGNSVTKGYYNNTELNQEVFQEGWFTTG
DLGYLFKGELFITGREKQEIIINGVNYFAHELETTIEELEGVKVSYTAAFAVFDQSRETD
LLIITFSPESDQFEHWIKVVRKIRSHLTQKFGIAPAYVIPLERNLVPKTSIGKVQKSKLK
KDFEQGLFSSRIQEIDQYLAKERQKNQTLPQSENERQIAAVWSEVLQLTSVGLEDNFFEL
GGHSIHLIRVQNELEKLFNRQLSLAEMFKNPTVATLARCLSEESNTTQVIAQKSRQRAEN
RTRRHNETHDIAIIGMAGQFPGAKNLTTFWENLKNGIETISFFSEEELQESGVSSELFNQ
PNYVRARPILEQVEYFDSEFFGYTDREAELLDPQQRLLLECSWECLENAGYNPSTYQGSI
GIFAGASMNTYLINNCYPNRGQLDSNDELQPFTLDSTGGFQTMVANDKDYLTTRISYKLN
LHGPSVNVQTACSTGLVVVHLACQSLISGESDMALAGAASINSPQKIGYLYQEGLIMSPD
GHCRAFDAEAKGTIFGSGVGVILLKRLSDALADHDHIYAVIKGSAINNDGGQKLGFTAPG
GEGQIAAATEALAFAGVDANTISFVEAHGTGTPLGDPIEVDALAKVYQGANEGECALGSV
KTNIGHMQIASGIAGLIKATLALKYRVIPPTLHFQNPNPQINFSQTPFYINNEAISWTTK
QDKDEKLPRRAGVNSLGIGGVNAHVILEEAPPIIPQDNQSKRPYHLLTLSARTEPALKEL
VSRYIDFLESQPEKDMSDVVFTANTGRVHFSNRLALTGYKNSDFIEQLRQFKQLDYQSTI
HGIADEKRPPKIAFLFTGQGSQYAGMAHQLYQTQPTFRKTLDAGENYYQKLTGKSLLNVV
FADTDDPLNQTAYTQPALFLIEVALAQLWHSWGIQPAAILGHSLGEYSAACFAGVFDLES
GLKLVTHRGNLMGQLPQNQGEMAAIFLDKNSVIEQCQSQGIKIAIAAINAEQHTVISGEK
SVIQELCNHFTNAGVKVRQLKVSHAFHSPLVEPMVAEFKTILQEISFSQPQISLVSNLTG
EIADDSIMTPQYWLQHLLNTVQFHPGALFLQSLGCDTFIEIGPQPILSGIVQSSLSSSEP
LTLPSLRSGFSDWQVLLESLGKLYVRGAKIDWFSFDQDYHPRRCALPTYPFQKRQHWIPL
KTPSATVPQESNLVKMLSEKDKNTLMQTLLETGHYSEDEKPTISAIVQQLIKLYYQEKED
FNFAKLLYQVAWLPWDLANGKLQNLTPLKTDLEVYLEPQLHSSELMGVSRAFSEMEKLAA
DFVVKALKDLELFQMNTFLDPDQSFIQAELKQEYKSFWNHLLEILAKVGILEKQNTLWKI
VKEPEHSNPDLAVEDLINHYPNAQIELNLFRQVATNLAAIITGKISPLSILFSQDGQGGA
SEFYKNTSSAKILNLGISKTVELLLSSYAPSASLRILEIGAGTGATTQQVLKACKSRQIT
YTFTDVSPFFLEKARDNLAEFSGLEYKVLDIEKAPKLQGFCCHSYDLIIAANVLHSTANL
QEETLPHIQSLLRPGGHLLLLELTQQSPWIDLIFGVTQGWWRFSDYHLRPNHPIITASTW
ESMLLKSGFSQVEFVSPDQKIGSVLFQQSIILAQSSEISPNTAKNWLIFTDIEPQQNTFA
LGIQEQLLKKCDSCRIIYQGEKNTQISSSESCLNANQLQQLEEWFASNPSPDRIIYLLNS
TPKEQPESILLNRCNYLLNLLKAIQTIPNPPQLFLVTQGAQPFELEQPSLGFQSPLWAMG
RVIALENPQLWGGMLDLDPDVDINQNITALLLGLTHAHDEDHLVFRKGQGYVARLLPLKS
LETTTVKIQTEATYLITGGIGHLGLELAEHLVNLGAKHLILTTRRSLPARFLWDSATELA
QISEKIRKLEEKGASIEVISADVGNFEAMQAIFTQIEKTAYPLRGIFHLAGISGRQAQLK
DCTLQDLEAVFQAKVKGSWNLHQLSLGTQLDYFVLFSSAGAIWGAKEQGLYDTVSHWLDA
LAHFRHLQQLPATTLNWALLAGHGIVSQDYEDWLKQIGIREIAPDMALRVMDAIMASNQT
QVLIADVDWVRFKNIYQFKGEKPLLKNLGLSEIPIKSVQESDSVLHLLEDIPLGERREYL
LEYVSKQVRIILGIKSMPDSEQGLIEMGIDSLSSIELKNRLEKGLEVLLPTSLIFDFPNI
RRLVDYLFDRIFGEKVQKTAEKMINFTEVQQEISEDLILQELTDLEAFLGD
Download sequence
Identical sequences B0JPW1 J9WME7 J9WMF6
449447.MAE_38630 gi|166366604|ref|YP_001658877.1| WP_012266632.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]