SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366692|ref|YP_001658965.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166366692|ref|YP_001658965.1|
Domain Number - Region: 15-84
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0385
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366692|ref|YP_001658965.1|
Sequence length 121
Comment hypothetical protein MAE_39510 [Microcystis aeruginosa NIES-843]
Sequence
MEGVVNLRREATLRIVVGNSNRQLQAVDAVIDTGFNGFLSLPSTIIATLNLPWSGSDFVT
LGDGSETYFDLYTGTVIWDGQYQEIDIAESETEPLLGMALLYRYRLQVDNIEGGKVKIEA
L
Download sequence
Identical sequences B0JQQ4 L7E1W8
449447.MAE_39510 gi|166366692|ref|YP_001658965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]