SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366734|ref|YP_001659007.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366734|ref|YP_001659007.1|
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.69e-47
Family Hypothetical protein VC1899 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366734|ref|YP_001659007.1|
Sequence length 226
Comment hypothetical protein MAE_39930 [Microcystis aeruginosa NIES-843]
Sequence
MGLDSSSLKNLPMSDAVTIADIYKLFERTEAQFAEFQKEADRRSAEADRRSAEADRRSAE
ADRRREEANRTMEELKKQVQETTKAVNNLTTRWGRFVEEMVEPAVVRLFQERGIDVTQTM
SRLKSKRSGAAMEIDIVAVNGSELVAVECKSRLSRDDVDDFVSRLQRFKVAFPQFREFRV
YGAVAGIEIDQGIDVYAYRRGLFVIKQSGETVKIINDTQFQPLGFA
Download sequence
Identical sequences B0JQU6
449447.MAE_39930 gi|166366734|ref|YP_001659007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]