SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366765|ref|YP_001659038.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366765|ref|YP_001659038.1|
Domain Number 1 Region: 7-271
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.84e-53
Family Bacterial dinuclear zinc exopeptidases 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366765|ref|YP_001659038.1|
Sequence length 282
Comment M28A family peptidase [Microcystis aeruginosa NIES-843]
Sequence
MFDLLSDRLSQHLEQIVRERNPFFSSQGHFYVREYLRQELGNWGKVESHFFSFQGKVYEN
LILDLPNNSQKPPILIGAHYDTVPGSPGADDNATGLAVLLELARFFGENQANYPIRLIAF
DLEEYGLLGSIAYAEKLKQTKQDLRLMLSLEMLGYCDKNPHSQKYPAFLEYFYPNTGDFI
ALIGNLKTRKDLNFLSRVMRENQTPCEWLPVIFGGYIVPDTRRSDHSPFWSRGYSAIMVT
DTANMRNPYYHSYRDTIATLDLNFLTRVCQGLCFGLQSLPMR
Download sequence
Identical sequences B0JQX7
gi|166366765|ref|YP_001659038.1| 449447.MAE_40240 WP_012266739.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]