SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366766|ref|YP_001659039.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366766|ref|YP_001659039.1|
Domain Number 1 Region: 7-311,391-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.28e-63
Family FAD-linked reductases, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 296-403
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.85e-29
Family L-aminoacid/polyamine oxidase 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366766|ref|YP_001659039.1|
Sequence length 460
Comment putative flavin-containing monoamine oxidase [Microcystis aeruginosa NIES-843]
Sequence
MTNLQWTSYDCIVVGAGLAGLIAARNLQRRGHQVLVIEARNRYGGRMSGQYLPSGQWIDR
GGQWVGPTQERFLALLDEYKIRRFPSPNQGKTVLVFNNKRYEFNGFFQGFHEGEVPDIGT
EEWQDAMSAWARFQELTKTLPSGYPQSNDHTKKLDSKTFAQWIEENTSTDFGQWYFAYMA
RAVGFLGPAEPNQVSLLHVLWGQNCAPQAEHPEAELIHGGAGQIPDKIAAELGERIRLGE
PVFRLNYDSAGVTVETSQNTFTAKFAIIAMPPHLAGRIIYHPPLPPQREQLTQRVPMGCC
AKILISYEQPFWRKQGLAGVAQGNCQWLELCADSSDPETGVGVIATFVVGDRYSRWRSMS
SPARRAAVLSDLAIYFGQEALFPISYDEVDWPGDPWTGGAYSAFMPPGVWTSFGEALFTP
VGPIHWAGTEMADRWPGFFEGAIRTGEAAADRIAFLLREK
Download sequence
Identical sequences B0JQX8
WP_012266740.1.4043 gi|166366766|ref|YP_001659039.1| 449447.MAE_40250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]