SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166366823|ref|YP_001659096.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366823|ref|YP_001659096.1|
Domain Number 1 Region: 351-599
Classification Level Classification E-value
Superfamily PP2C-like 3.27e-51
Family PP2C-like 0.0001
Further Details:      
 
Domain Number 2 Region: 189-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000444
Family Protein kinases, catalytic subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366823|ref|YP_001659096.1|
Sequence length 607
Comment protein serine/threonine phosphatase [Microcystis aeruginosa NIES-843]
Sequence
MTSPSTENFSPLLIQEKESFSMADYQIEIIAYLGLLTADVYYFKVKFQPIADLDGEKGET
SSQLGLLRVGSLNSSLDRELQLRKILQNYSLIAPLIADIQVDSAIINPLSIKEKSQEVDE
KQNEDIATEQIVSEDSEFVNITSTKDDDSGENQSAETDYLEEEYYPETAVENETKPEKLL
LLTRFPQENLTLEAWLKAEHSQEEALTLVIQVCQLFSYIAKQNWYLINLLPQFIEIDKPL
KIFDLTCAYSIEESLTSGVIGDYCAPELAASRSINESMSSYTIAALLYQTTHKKLPQSDQ
IISLEIAPIPRLYQLLKIALSSLPEERFPLAQFLSLLIETRHSLRSLKVQWNIASYSTVG
LSTERLQNEDNYGVRQQHLSNSETLILGVVADGMGGMSQGEVASQIAVKTILQDSLPPEF
KTGEQRNEWLLNLFQKANISIADTVRNGGTTLSVVLAINDSLMIAHVGDSRIYLIRQGKI
KQLSEDHSLVAMLVANGEITEEESLTHPDRNVLLKSIGSKKHLSEGYVQNLTRTTGNLSM
TLENEDILLLCSDGVWDLVPTQELAEIFSQFESLQMAVDQTIQRVINQGATDNATLLAMQ
CFMTSGT
Download sequence
Identical sequences B0JR35
gi|166366823|ref|YP_001659096.1| 449447.MAE_40820 WP_012266787.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]