SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366846|ref|YP_001659119.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366846|ref|YP_001659119.1|
Domain Number 1 Region: 21-104,137-180,252-416
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.38e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.02
Further Details:      
 
Domain Number 2 Region: 416-603
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000279
Family Filamentous hemagglutinin FhaB, secretion domain 0.02
Further Details:      
 
Domain Number 3 Region: 620-744
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000785
Family iota-carrageenase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366846|ref|YP_001659119.1|
Sequence length 927
Comment filamentous hemagglutinin-like protein [Microcystis aeruginosa NIES-843]
Sequence
MLKFRNLVSLLVSLSLFSVKSPAIAQIIPDTSLGIESAFVITFNQLLQLIQGGARRGENL
FQSFQDFNIREGQTIILTNPNGVNNILIRVTGNNPSDILGNLSLIKAETINNLLINLRSL
SLLPNTNLSSLIQPQDLGTASLFFLNPNGILFGPDARLNLGGSFIATTANQIKFADGTVF
SANLTQSSPILTISTPIGLGFTSSSPKPITLQGPEQSLTGVLQSIPKVTGGPNEVLEGTK
TLIENILTRPVGLQVFPNQTIALVGGDVTLNSGSLTALGGRIEVGSVRNMGNVSLTPVPK
GWRLGYEGIDSQSQGQITLSQLALLNSSGLGGGEIKLTAQKVALINESAILSVTLSDQDG
GDISIQAQDIRLSNGSIIGTGTFIDTLGDSGSVIIKTNNLTVQGASLIETTTLGQGKGGN
LIINAQNGVNVIDDGFIAAGSLGASQDQTGSAGNLIIETQILNINEGGEILNATSSGQGG
NLIINASESINIDDFDSAIYTDTFGRGNAGNLEINTKTLRISNGAQISAATFDQGKGGDI
LLRASDSLYITGISSDLRFPSGIFTSTGIIGFDFQSQGEGGNLLIETRRLTLTDGAVIST
STISPKNAGNAVLNISDTLSLERNARITASTSADGNAGNIRLNVGNELLMNQNSQISTAV
TRNSLARGGLIEINANSLNLQNQSEISVRSEGEGNAGNININLTGLFSATNSDITANANQ
GAGGEITLTADNIRLQGDSDIRTNVNNGAGGGGNITVTANSILLFNDSDILAFSRDGRGG
NIQFNTPVFFGNGYQRISSESDPNTLDGNDRVDINASGAVSGAIIIPDLTFIQNSIVQLP
EFLINPEKLLANSCISPNQNRGGSFIIKGSGGVQNRPGDMNTPSYFPEIIQPIPETPAQP
WKKGDHIIEPQGVYTTLDGRLYLSRKC
Download sequence
Identical sequences B0JR58
gi|166366846|ref|YP_001659119.1| 449447.MAE_41050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]