SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366881|ref|YP_001659154.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366881|ref|YP_001659154.1|
Domain Number 1 Region: 369-575
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.71e-32
Family TK-like Pyr module 0.041
Further Details:      
 
Domain Number 2 Region: 47-311
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.61e-31
Family TK-like PP module 0.0067
Further Details:      
 
Domain Number 3 Region: 581-730
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000277
Family Transketolase C-terminal domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366881|ref|YP_001659154.1|
Sequence length 732
Comment transketolase, central region [Microcystis aeruginosa NIES-843]
Sequence
MTATSTIPDFCQGIKYFGGSLPEFDKYAGKAAIAEGKTAIIAANDPNAIYQTLLAADALR
YLTLQITATKESGHPGGFASAADVIASLMMLGQKNIFTEVGHHAPGFYSNVFLDRSLEAM
GISNVRELGERFREKHGLLGHLSGQIPGLLGPAGPLGQGQHFAMAAAKLHPNTLFPVTIG
DGGLGEPYIMSSFGHFHTAYPEITNFLPILVWNGYSQEHHSMVSLKTNAEMEAYWRGNGF
EEVILINAKDFDNAHQNGEYVDSTKFSFNQRLEFMKAVLMATDKAAQLALGGKLTVIIIK
QLKGAGVHKRGAASHNLYPGDSLEKDYIVAALQERALPPEAWAIVRTNFERSGGGPAVET
VVTEKVFPLPDLGTLPMTEYTVGGDKKVATTAMGELVVAVGKADPNFVVTNADGNAASGI
NNINVGLKIIHPTSDDTYFQAPNGQVYEPLSEDACAGLAVGLSLLGARTLWCSYESFAIN
GLPIWQTVTQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIENYFAAMMRNGNIFP
LFPCDANSIQVCYEWALGTSNKGITITASKSPLPVRTTFEQTRQALEKGGVILHESEGSK
KVVFAVIGDMTLLPVFESAQQLEAAGIGVKIVSVINPRRLYRPSDVMSETSSAADNNFLD
DAGFDSLFAGDALIGVTGGTSAMLEPIMLRSNTRRDVFAWKRGETTASAGEIMAYNGLTA
NALTVRATQLLG
Download sequence
Identical sequences B0JR93 I4FQW0
449447.MAE_41400 gi|166366881|ref|YP_001659154.1| WP_002760845.1.24258 WP_002760845.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]