SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366901|ref|YP_001659174.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366901|ref|YP_001659174.1|
Domain Number 1 Region: 11-340
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.13e-50
Family PepX catalytic domain-like 0.000066
Further Details:      
 
Domain Number 2 Region: 335-544
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-47
Family PepX C-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366901|ref|YP_001659174.1|
Sequence length 547
Comment peptidase S15 [Microcystis aeruginosa NIES-843]
Sequence
MFNPYPIKKETASLITRDGISLVADIYRPDSRESLPILLMRQPYGKAIASTVVYAHPSWY
ARQGYIVVIQDVRGRGNSTGNFNLFAHEIRDGLETIEWVLTIPNNTGVVGMYGFSYQGMT
QLYAATNGHAALKTICPAMIAHDLYRDWGYENEAFNLQYNLAWAIQLAAETARLKGDETA
YQKLWVASRNLPLFDPIAASPQILQDLAADSFYHEWITRYLPDEYWQKLSPQNLLKNIDL
PMLHIGGWFDPHLRGTLGLYQEMQARSIYPQQLIIGAWTHLPWGRKVGEIDYGQQAISPV
DKMQLQWFDYFLKGQEVELFENPPMYLFQMGSNQWRYLEKFPRENQQIYYLASQGLANLR
EDEGKLSAILLEPAIEDTIVHDPWRPVPSLGGHSALPGGIFDRTMLDCRSDVITYTSPPL
EKDLTILGSPRLDCYCQADAVSFDICAVVSQVTPDGRVFNITQGYKRVNNPESPLNIALQ
ATFITIPQGHSLRLSLSASCFPAHPVNAGTGSYPHASRAINFSVITIKVFCQGNFPAKLL
LPLVGES
Download sequence
Identical sequences B0JS24
WP_012266843.1.4043 449447.MAE_41600 gi|166366901|ref|YP_001659174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]