SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366917|ref|YP_001659190.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366917|ref|YP_001659190.1|
Domain Number 1 Region: 947-1136
Classification Level Classification E-value
Superfamily beta-Roll 2.88e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 838-958
Classification Level Classification E-value
Superfamily CalX-like 3.79e-23
Family CalX-beta domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|166366917|ref|YP_001659190.1|
Domain Number - Region: 273-613
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00345
Family Pectate lyase-like 0.086
Further Details:      
 
Domain Number - Region: 19-429
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0122
Family Pectate lyase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166366917|ref|YP_001659190.1|
Sequence length 1212
Comment hypothetical protein MAE_41760 [Microcystis aeruginosa NIES-843]
Sequence
MLWDNGILSSVASINQIGSLSILGASHKYLYTSLINSGTISQNISGYTLFLNQSANINNS
GIYEFQAGEIRNAPNSVGVFNNSGTFRKTSSGLSIVSVPFYNTGTVNVELGTLLLLGGGS
SNGGIFNISSGGTLEIKSSSSLTNNTYFLDSNAQINGTGTLMISGGFLELARDWAFPTTT
INILWSAGIKSSGTVTNPGSLTIQNSAYLYASLNNTGTITHLILRRSSPGTVSSLSLNQS
ANINNSGIYEFQSGELDNEIRNAPNSVGVFNNSGTFRKTNAGTAIVSVPFYNTGTVNVEL
GTLLLLGGGRSNGGIFNISRFGTLELKSAGATLTNNTYLLDSNTQINGTGTLMISGGFLE
LDSDWTLPTTTINILRNAGIKSPGTITNAAGLTIQGNAYLYASLNNTGTIVQNLVLSNPS
DRLSLNQSANINNSGIYEFQAGEIRNQVDSIGVFNNSGTFRKTSSGLSIVSVPFYNTGTV
NVELGTLLLLGGGRSNGGIFNISRFGTLELKSAGATLTNNTYLLDSNTQINGTGTLMISG
GFLELDSDWTLPTTTINILRNAGIKSPGTITNAAGLTIQGNAYLYASLNNTGTIVQNLVL
SNPSDRLSLNQSANINNSGIYEFQAGEIRNQVDSIGVFNNSGTFRKTSSGLSIVSVPFYN
TGTIESVMGTVSFYNSYTHNNANLILKSGNVSFTNPLTINGGNIEGNGNINATITNSGLL
NPRYVSNTEFGRLTINGNYTETNNASINIQLGGNTAAVNFDQIDINGTANFDGTLNVSLL
NGFTPTLGSTFDVLTYDALNSLSNLDFTGLDINSTLQFLPQWSSNKLTLKVVDKSAPILA
IAPTNVVESESHSGTKPFTFTVTRSVNTTGTNNVNWAVTVTGSGSNPANATDFAGGLLPS
GVVSFAAGETSKVITVNVQGDTTVEPNETFRVTLSNPTNGATITTATAIGTIQNDDFIGT
SGPDTLAGTSGADAMTGLAGNDTYTVNNAGDLVIEALNQGTDTVQAAISYTLPNNVENLL
LTGTGNLNGTGNALNNQITGNSGNNNLNGAAGTDTLIGGTGNDSLNGAAGIDTLTGGVGT
DIFIFQFSQSTSAALDRVTDFAIGDDKIDLLSQAGGAINAPVAFTRAANSTTTNINTIVT
NVFTDANGATAGNQALGTNSAALVRDNSSSTYLIINDGTAGFQSANDLVINLTGLTGAFP
ALGTIAVNSFFV
Download sequence
Identical sequences B0JS40
449447.MAE_41760 gi|166366917|ref|YP_001659190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]