SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166366918|ref|YP_001659191.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166366918|ref|YP_001659191.1|
Domain Number 1 Region: 12-63
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000409
Family monodomain cytochrome c 0.022
Further Details:      
 
Domain Number 2 Region: 58-70,138-166
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000922
Family Cytochrome c3-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166366918|ref|YP_001659191.1|
Sequence length 170
Comment hypothetical protein MAE_41770 [Microcystis aeruginosa NIES-843]
Sequence
MPSSGQVKSIFFLILFLLSILGGILLASLLKQPAIAQSPSSDTVLNRYQIGQQTYLENCA
TCHIAIPPSILPSQTWKKILENPNSHYGIRLKPIVGITQRLIWDYLSYSSRPLTQTTFVP
LLIEQSTYVKVLHPRVNLPTPLGHTTCVSCHPNASRYDYQTLTPIWDNAA
Download sequence
Identical sequences B0JS41
gi|166366918|ref|YP_001659191.1| 449447.MAE_41770 WP_012266859.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]