SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367086|ref|YP_001659359.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166367086|ref|YP_001659359.1|
Domain Number - Region: 4-19,96-115,145-156
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000377
Family Cytochrome c3-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367086|ref|YP_001659359.1|
Sequence length 170
Comment hypothetical protein MAE_43450 [Microcystis aeruginosa NIES-843]
Sequence
MESKTCAKCHTTKPISEFHKDKRLKSGTVARCKSCTCEYKRQYYASSEGNAKIKAYIERN
KEKRSTYSKQYSQKYRDAQFKNQKKLEFCLYKGGYCSECGFAATEDTIAAFDFHHIEPSE
KEYTPSDMLMLKKEKVFKELDKCILLCSNCHRILHHRQYRAKLLEKKQKV
Download sequence
Identical sequences B0JSK9
gi|166367086|ref|YP_001659359.1| 449447.MAE_43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]