SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367192|ref|YP_001659465.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367192|ref|YP_001659465.1|
Domain Number 1 Region: 11-342
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.84e-103
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367192|ref|YP_001659465.1|
Sequence length 344
Comment pyruvate dehydrogenase E1 component subunit alpha [Microcystis aeruginosa NIES-843]
Sequence
MISERTLPTFNPASIIITKAEGLRLYEDMVLGRMFEDKCAEMYYRGKMFGFVHLYNGQEA
ISSGIIKALRQGEDYVSSTYRDHVHALSAGVPAQEVMAELFGKATGCSKGRGGSMHMFSA
EHKLLGGYAFVAEGIPVATGAAFQSKYRREAMGDASADQVTVCFFGDGASNNGQFFECLN
MAALWKLPIIYVVENNKWAIGMAHDRATSQPEIYKKASVFSMVGVEVDGMDVVAVHAAAR
EAVARARAGEGPTLIEALTYRFRGHSLADPDELRSADEKQFWGERDPITRFAAYLYERDL
ATREELKEIEQKIQAEIEEAVKFAESSPEPDPSELTRFIFAEDE
Download sequence
Identical sequences B0JTH0
449447.MAE_44510 WP_012267065.1.4043 gi|166367192|ref|YP_001659465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]