SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|166367204|ref|YP_001659477.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367204|ref|YP_001659477.1|
Domain Number 1 Region: 4-238
Classification Level Classification E-value
Superfamily PP2C-like 4.97e-63
Family PP2C-like 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367204|ref|YP_001659477.1|
Sequence length 240
Comment protein serin/threonin phosphatase [Microcystis aeruginosa NIES-843]
Sequence
MNNLSFGGMTDPGVVRSVNQDSYYIDPERRFFIVADGMGGHAGGQEASQIATETIQAHLE
EHWNSPRAAGELLQEAITAANEKIIEDQLKNPERQEMGTTLVIAIFRDDGSWYTHIGDSR
LYRFREQKLEQVTEDHTLIARAIKMGDMSEEDAKNSPYRHILLKCLGRPGLLPVTVSPLD
VQSGDSLILCSDGLTEEVSDEEISDYLQTGADCQEIVENLVAAAKKAGGSDNITVVMVSC
Download sequence
Identical sequences B0JTI2 I4I5E2
WP_004162704.1.4043 WP_004162704.1.50331 gi|166367204|ref|YP_001659477.1| 449447.MAE_44630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]