SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367235|ref|YP_001659508.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367235|ref|YP_001659508.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.75e-48
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000109
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 5.61e-19
Family TS-N domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367235|ref|YP_001659508.1|
Sequence length 251
Comment elongation factor Ts [Microcystis aeruginosa NIES-843]
Sequence
MAEITAQQVKELREKTGAGMMDCKRALTENAGDITKAIEWLRQKGITSAEKKASRVAAEG
MIGSYIHTGSRIGVLVEVNCETDFVARREEFKKLVNDVAMQIAACPNVEYVKVADIPAEI
AAKEKEIEMGRDDLANKPDNIKEKIVAGRIEKRLKELSLLDQPFIRDQNISIDELLKQAI
AALGENIQVRRFQRFVLGEGIEKEETDFAAEVAAQMGQKAPEPVAAAPQVEEKAPEPAAK
DNPPAKGKKKK
Download sequence
Identical sequences A0A1V4BPP2 B0JTL3 I4F8F8 I4I3T7 I4IP68
gi|166367235|ref|YP_001659508.1| WP_002753383.1.13945 WP_002753383.1.4043 WP_002753383.1.43950 WP_002753383.1.5315 WP_002753383.1.79847 WP_002753383.1.98808 449447.MAE_44940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]