SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367426|ref|YP_001659699.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166367426|ref|YP_001659699.1|
Domain Number - Region: 36-85
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0698
Family Di-heme elbow motif 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367426|ref|YP_001659699.1|
Sequence length 384
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MWINFDQLLDLPNVTVVNYQKIDETIFLKLALLNETIECPNCHQTLDRINQTEYNLVRDL
SILGNRVYLEVPRRQFHCQKCQKYISERLSFMRLRQHHTIRYESMIYERVKNCSIEEISR
EEGLGWSEVELIFNHCAKELEKEEWEAPERISLDEFSNLKGHKDFITTVVDLDKKILLDV
IKGHKQEELMEALKAQPEAVREKVKEVSVDMWSGFTAVIKELFPNAKIIYDRFHVMAIIN
DELNKLRKLMGVHEKGLPHLLWKNKEDLKDEQKQQLEVILKEHPCLGIAWEMKEEIRQIY
QSSRTFRGAERKLEKWIRIGGILYESGASMIQKHLQGICNYFENHTTNGLIEGMNTKIKL
IKRMSYGFTNFQHLRLKLFACFNS
Download sequence
Identical sequences A0A2H6L9W7 B0JRB9
WP_012263878.1.4043 gi|166362883|ref|YP_001655156.1| gi|166367426|ref|YP_001659699.1| 449447.MAE_01420 449447.MAE_46850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]