SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367443|ref|YP_001659716.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367443|ref|YP_001659716.1|
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.15e-63
Family Inorganic pyrophosphatase 0.0000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367443|ref|YP_001659716.1|
Sequence length 169
Comment inorganic pyrophosphatase [Microcystis aeruginosa NIES-843]
Sequence
MDLSRIPAQPKPGLINVLVEITAGSKNKYEFDKDLNAFALDRVLYSSVQYPCDYGFVPNT
LADDGDPLDGMVIMDQPTFPGCVITARPIGMLEMIDGGDRDEKILCVPAKDPRYAEVKSL
KDVSPHRLQEIAEFFKTYKNLEKKVTEILGWKDVDAVTALVEQCIAAYK
Download sequence
Identical sequences A0A1V4BP20 B0JUS6 I4HWU3
gi|166367443|ref|YP_001659716.1| WP_004162542.1.4043 WP_004162542.1.50331 WP_004162542.1.79847 449447.MAE_47020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]