SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367555|ref|YP_001659828.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367555|ref|YP_001659828.1|
Domain Number 1 Region: 134-291
Classification Level Classification E-value
Superfamily beta-Roll 5.89e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367555|ref|YP_001659828.1|
Sequence length 328
Comment hemolysin-type calcium-binding protein [Microcystis aeruginosa NIES-843]
Sequence
MPTVTISFASLPGPTGASFNPTVTTSVAAFLNAHPTVPISISTTGLTADNLTSLGLLSTG
GDTVWRIANAGVADSATLSRAGGGFSKTLSLPANSLTFVRGGSAGTYQLTGGIVNTKASG
PQVVSSIAPLLLTDSYFITGSAFNDTLTGGNSTDTLIGGDGNDVLSGGEGADTLIGGNGN
DTLNGGNGFDSLIGGDGNDIISGIGGADTLIGGLGSDTLTGGNGNDRFVYNNPNEGGDLI
ADFNIASGNTDAIVVSNGGFGGGLTTVGGTLAPSLFGATAGGAVRFVYSGGVLQFDTDAG
LGVSLVTIANIGGSGAATLGASNIQVIA
Download sequence
Identical sequences B0JVP3
449447.MAE_48140 WP_012267314.1.4043 gi|166367555|ref|YP_001659828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]