SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367614|ref|YP_001659887.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166367614|ref|YP_001659887.1|
Domain Number - Region: 13-71
Classification Level Classification E-value
Superfamily Tropomyosin 0.000981
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166367614|ref|YP_001659887.1|
Sequence length 102
Comment hypothetical protein MAE_48730 [Microcystis aeruginosa NIES-843]
Sequence
MSNETVTYSLEAVLTRIEGKIDSLEKRVNERFDKVEDRLTKLEIGVTDLKGDIKVLDEKI
EGIDNRLKSVEGTQKNQVWTLIILLGSAIITAGWKVFFSSNI
Download sequence
Identical sequences B0JVV2
WP_012267354.1.4043 449447.MAE_48730 gi|166367614|ref|YP_001659887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]