SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367631|ref|YP_001659904.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367631|ref|YP_001659904.1|
Domain Number 1 Region: 338-495
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.92e-18
Family HD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367631|ref|YP_001659904.1|
Sequence length 710
Comment glycyl-tRNA synthetase subunit beta [Microcystis aeruginosa NIES-843]
Sequence
MDFLLEVGTEELPADFVDSAIAQWRERVSKSLETESLDATAIQVYATPRRLAVLITGLPT
EQEARSEEIKGPPVSAAYKNGQITPAGEGFARKQGVSTAAFSIRATDKGEFVYIEKTIPG
RPTAEILTELIPQWITRLEGRRFMRWGDGDLRFPRPIRWLLTLVDGEVLPLELINGSTTL
TSDRLTFGHRILHPQSLAISHPQAYLTSLRSIFVEADPQVRQQIITAQITTLAKKLKGVA
EIPADLLAEVTNLVEYPTAIVGKFDDEFLELPPEVIITVMVTHQRYFPVKTPQGLSPYFI
TISNGDPQKSEIISAGNERVIRARLADARFFYTADCDEPLDSFLPQLETVTFQEELGTMR
DKVDRIMEIAQMIVEQLNLDEQSRSDIESTAMLCKADLVTQMVYEFPELQGVMAEKYALI
SGESAVVARGIFEHYLPRNAGDILPETITGQVVGIADRLDTLVGIFGLGMLPTGSSDPFA
LRRAANAIISIIWSANFNINLLALIEQIAKDFVTCHPDKPNPANLIKDFFLQRLQTLLID
DLRIDYDLVNAVLGENDPEYKSRALENLLDTRERARFLCQIRQDGQLANIYETVNRSTRL
AQKGDLDTTTLEAKGIINTELFEQSSEPAFYDALIALIPETISAREQRDYQRLVTALTAI
SPLVADFFDGENSVLVMAEKESVRRNRLNLLGLLRNHARVLADFGAIVKG
Download sequence
Identical sequences B0JVW9
WP_012267368.1.4043 449447.MAE_48900 gi|166367631|ref|YP_001659904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]