SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367763|ref|YP_001660036.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367763|ref|YP_001660036.1|
Domain Number 1 Region: 690-796
Classification Level Classification E-value
Superfamily CalX-like 7.46e-25
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 2 Region: 222-333
Classification Level Classification E-value
Superfamily CalX-like 8.37e-23
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 3 Region: 8-169
Classification Level Classification E-value
Superfamily beta-Roll 3.27e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Domain Number 4 Region: 571-691
Classification Level Classification E-value
Superfamily CalX-like 3.27e-17
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 5 Region: 805-975
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000746
Family Serralysin-like metalloprotease, C-terminal domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367763|ref|YP_001660036.1|
Sequence length 979
Comment Na-Ca exchanger/integrin-beta4 like [Microcystis aeruginosa NIES-843]
Sequence
MTYDTVTGNGTVITGNKVDTLISIERCNLFGTEDNDFILGGWGSDSLLFSTSEGLRGNGG
DDTIDGNSGEDLLFGEDGNDFLIGGWGSDALVGGDDNDRLIGVNPNASTPGQNEQDDLYG
GAGADLFILGDANWSGYDDGSTSSSGSGDYADIQDANFSEGDRIQLRGSRADYLVQQRPF
SSDTVEIYLIKPLWEPDELIARVRGYISLGDEVFVFVPAGPVTTITVAVSDASAGEPANA
GVFTLTRSGNIGNALTVNYLLAGSASNGVDYSNLTGRVTFAAGSSTATVTINPLEDTAIE
GNEVVLLQIAEGTGYTLGATSGAVITLTDNDVYTAIEPASLGSNITLVRDSANRLSARSS
EETLPLYSLEDTPLQIGQYPDWQALAVERIDGLNQILWKNTRNNYLQVWYTDTNWRWLGG
DSTNGLNTLDAYNLEKKFQFDANGDGRIGMTFTNLEAAGSVAIVRDTLNRLYARTSLGDT
AIGAINGTPLTETSNPGRQILGAETLNGINQIVWRNTTTNALELWTMDGDWQFAGNDAPI
APTSPTALQLELDFEMDLNGDTVIGRLPNLPDITLTVSPATVTENGTPNLLYTFTRRGPL
TNPLTVNFNVTGTATLTTDYTQTGALTFTATGGTVRFNAGASTAIITLDPVGDALIEPNE
TVSLAITPGVDYTRGTTEAITGTIANDDLPTLTIDNLIFLEGLEANALIPVRLNGPFGEP
IRVNYTTANGTAIAVADYTASSGILTIPANTTTAFIRIPIANDTLNEADETFTVTLSNPV
NATIARAMATITITDTLESDVSTVLTNGLENLQLTGTNPINGTGNAGNNRITGNSGNNIL
NGDLGNDTLAGNAGNDTLTGGAGIDQIEYRSTRAFVASDFGVDTISDFVVNQDKIVLSKT
TFAALTSGVGNGFNQPSNFAVVANNSLVAASNAFIVYSSGTGHLFYNQNGSVAGLGTGAN
FAVFTGNPSLTANDFLLVA
Download sequence
Identical sequences B0JWV7
gi|166367763|ref|YP_001660036.1| 449447.MAE_50220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]