SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367811|ref|YP_001660084.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367811|ref|YP_001660084.1|
Domain Number 1 Region: 206-381
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.03e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 389-602
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.26e-64
Family Pyruvate oxidase and decarboxylase PP module 0.0000126
Further Details:      
 
Domain Number 3 Region: 16-195
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.36e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367811|ref|YP_001660084.1|
Sequence length 617
Comment acetolactate synthase 3 catalytic subunit [Microcystis aeruginosa NIES-843]
Sequence
MVSSLPKPNDSLTTVPQRCSGAYALMDSLKRHGVKHIFGYPGGAILPIYDELYRFEERGE
LQHILVRHEQAAAHAADAYARATGKVGVCFGTSGPGATNLVTGIANAHMDSIPMVIITGQ
VSRAAIGSDAFQETDIYGITLPIVKHSYVARNAREVARIVAEAFHIASTGRPGPVLVDIP
KDVGLELCDYIPVEPGDVKLTGYRPTVKGNRRQIEAALHLLETAEKPLLYVGGGAIAANA
HAQIAEFAERFQLPVTTTLMGIGAFDEHHPLSVGMLGMHGTAYANFAVTECDLLIAVGAR
FDDRVTGKLDEFASKAKVIHLDIDPAEVGKNRAPDVPIVGDVRVVLEQILQKAREFDYPT
NSDRTQAWLAQIERWRQDYPLQVPRPEGRLSPQEVIVEVGRQAPHAYYTTDVGQHQMWAA
QFLKNGPRRWISSAGLGTMGFGLPAAMGVKVAIPDEEVICISGDSSFQMNLQELATLTQF
NIHAKTIIINNGWQGMVRQWQEAFYGERYSNSNMEAGMPDVELLAQAYGIKGITIRHREE
LAAKIAEMLAHDGPVLVNAIVTKDENCYPMVAPGQSNARMIGLPKIVTGGCEMLNCPSCG
AVNSWNNKFCPECGAKL
Download sequence
Identical sequences A0A1V4BVX3 B0JX05
gi|166367811|ref|YP_001660084.1| WP_012267501.1.4043 WP_012267501.1.79847 449447.MAE_50700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]