SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367829|ref|YP_001660102.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367829|ref|YP_001660102.1|
Domain Number 1 Region: 233-442,597-726
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-31
Family Subtilases 0.0042
Further Details:      
 
Domain Number 2 Region: 995-1154
Classification Level Classification E-value
Superfamily beta-Roll 1.31e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00073
Further Details:      
 
Domain Number 3 Region: 728-836
Classification Level Classification E-value
Superfamily CalX-like 8.37e-20
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 4 Region: 888-1017
Classification Level Classification E-value
Superfamily beta-Roll 1.18e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166367829|ref|YP_001660102.1|
Sequence length 1225
Comment hypothetical protein MAE_50880 [Microcystis aeruginosa NIES-843]
Sequence
MKTTQVSSDSSSIDVPSLKDALGFEQSFPITVDLTGSDDLTVSIETLVQAGQNAAGNRVA
LVIKSNNIQGLLPSLQELGFQIIETNSTDNQIKGFLPIQRISGLADLHSSSSGGSGGVNS
GNVLPAGTVEEQTTSVPESNNASVIPFDFSKLQAFTNGVKAGSYKKLSSNLSALLTGSNV
FNSQTNSPLKVESALQTTTTGVAIEAIADTNSYQLLAELQTLGLQNASLFGRIISGVIPL
SSLGQMANLSSLRFARPAYKPVTNKFDYLGTSPGPVTNTGSVTSQGDKAQRSDIARTTFS
VNGAGVTIGVLSDSYNNLGGAASDVASGDLPTGVIVLDDFASGGSDEGRAMMQIIHDVAP
GSTLAFHTAFEGLASFANGIINLAKPVASGGAGAKVIVDDVFYFAEPFFQDGIVTQAVEQ
VATTGVAYFSSAGNQARQSYESVFTAGQTAGDYTFHDFDPSGAVNVFQKITINNGEFVPI
LQWDQPFASASTTGAGSQNDLDMFLFDGDGNIIASSVDANVDGDPFEFLEVQGTGEVFLA
IAKWNPGGGPNPSKIKFVDVGFNSTYQFATNSSTSFGHNQAPNGQGVAAAYYQDTPAFGT
NPPEPEPFTSLGGTPILFDTAGNRLATPVIRNQPAITAPDGVDTTFFGFDSDGNGKPNFF
GTSAAAPSAAGVAALMRQKVPGVTNTQIYNALKSTAVDMNTPGYDFLTGNGLIRADAAIA
YILPSSTISIAKTTDGKEAGSVSSVFTLTRTGDLSSALTVNYTLAGTATPGVDYTNPGAG
KATFAAGSSKATITLPTIDDLLSDPSETIITKITAPTGYTISGPDNATATILDNDGNAAN
DNLVGTSFADALAGVGGNDTLSGLGGNDTLDGGASNDTYLFDTDLVLNSDRLIDASGIDT
LNFAATTTKTINLNLGSTVAQTVTAGNLTLTLASATAFENVIGGSLNDNIVGNTLANSLN
GGAGNDTLSGLGGNDTLDGGAGNDTYLFDTDLVLGSDRLIDASGIDTLNFAATTTKTINL
NLGSTVAQTVTAGNLTLTLASATAFENVIGGSLNDNIVGNTLANSLNGGAGNDTLNGGAG
NDNLNGGAGNDNLTGGLGKDTLTGSTGLDTLTYNALGESLLTGFDVIQGYSGTGASLDSI
NAPGSIAAINLTASKGTATALTEAAIQAVLTATKFAANTAAAFKVTGQSGTFIALNNGVA
GFQAASDAIIQLSGYNIDVAPVVVI
Download sequence
Identical sequences B0JX23
WP_012267516.1.4043 449447.MAE_50880 gi|166367829|ref|YP_001660102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]