SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367894|ref|YP_001660167.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367894|ref|YP_001660167.1|
Domain Number 1 Region: 173-436
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 1.44e-46
Family Hypothetical protein YwqG 0.00023
Further Details:      
 
Domain Number 2 Region: 33-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-17
Family Galectin (animal S-lectin) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367894|ref|YP_001660167.1|
Sequence length 442
Comment hypothetical protein MAE_51530 [Microcystis aeruginosa NIES-843]
Sequence
MAKQSFDLAKLRLGIYQDRIFLGVPLQELLVAVEITAICHYPTFTINLDAGSDIAYHFDA
RSSEGRIVQNTCVAGAWGAGGEILSMPPEFVSSQPFTLKIAVEQELVVYLNGRVLTRYAH
CLPLTQINTVHIVYPPENLQVQSVQVFEQTAPAIEQPPLPPQEITDMPAFLENLPPQFEP
LRLFLEANLVPYIKFTATDAGHLNSASFRGPADWSGDPLELWQSKIGGHPYLPKGTSYPT
DAETGEMMMFLMQINCADLPVIESLNLPRQGLLQFYIGLDVPMCTLSPEQHRVLYYPDVS
KDKNDLITDFSFLAEPASSLEWYDDVYALNFSVQRDVFWNARRQLDESFEMPEALTELGE
DFTEWISDYEDECTLRHGRINKLGGYPELHSYVDETIEGFRGRLLLELQHPFDIDNNFYF
FIEDLDLANLNLSNVESYFVSV
Download sequence
Identical sequences B0JX88
449447.MAE_51530 gi|166367894|ref|YP_001660167.1| WP_012267557.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]