SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166367962|ref|YP_001660235.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166367962|ref|YP_001660235.1|
Domain Number 1 Region: 559-657,684-705
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000576
Family HD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166367962|ref|YP_001660235.1|
Sequence length 782
Comment metal dependent phosphohydrolase HD region [Microcystis aeruginosa NIES-843]
Sequence
MNHFLHSFTVFPDSARKSRSYSLGKLRRPLIFLFTVGCLTSVVGYRFYNQPKLAVGTISP
VTIIAPEDARFQDQETTALKRQKIRAGLLPRLKRDPQTTAQIERSLRDTLGQLSQISPIL
RRNSILMGRNISNATMETLLTFSAPQWSTLQSRLNYEESFTNLLTKEQEYAVSEIQAYRQ
RVTKGSFEQFIDRLGQLRQIKEQTSQNYRHSSLNKLKYADLITAAQMGDREWQNLEKALL
QAGRRILVQGIPPGISTSHLQDTIAVQISSDRLTSRQQSLAENILLAALEGEANLIEDRE
ATKEQATKAVEAVDTVMSSAQTGQIIVKAGEKITQAQFVLIDGFGLSERGINWMGLGSTA
ILVTSAIGTFCLVAQRLHRPLRHRDFILLGLLSFTTPILAIANIPFTNLAAVGLLVSSFY
GPTLAVTQVLLTAGLSLFSSQGISADLIAGTIGGLLAAMIAGKLRSRDELSLLGMGIGVS
QGGVYLLTYLIVSATASTIIYTLLPTALVYGLSGIAWTVIALGLSPYLERCFDVVTPIRL
VELSNPNCSLLKRLATEAPGTFQHTLFVACLAEAAARKLHCNVELIRTGTLYHDIGKMHD
PLGFIENQMGGPNKHDEINDPYVSAEIIKKHVSEGLVMARRHGLPRVIRDFIPEHQGNLL
ISYFYQQALQKSAQNGQEFVDEAAFRYDGPIPQSRETAIVMLADSSEAALRSLKEASPEQ
AMDMIKKIFQARWRDQQLVDSGIRQEELPIIAEVFVQVWQQFHHQRIAYPKAVLEVSSAK
KI
Download sequence
Identical sequences B0JY05
449447.MAE_52210 WP_012267607.1.4043 gi|166367962|ref|YP_001660235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]