SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368007|ref|YP_001660280.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368007|ref|YP_001660280.1|
Domain Number 1 Region: 12-221
Classification Level Classification E-value
Superfamily PhoU-like 7.53e-57
Family PhoU-like 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368007|ref|YP_001660280.1|
Sequence length 222
Comment phosphate transport system regulatory protein [Microcystis aeruginosa NIES-843]
Sequence
MSLSKETNHPDRTYFARSLQRLEQDVLRMGTLVEESFRLSHQSLFARDLEMAKKIAPLDK
EIDRYYRQIELDCATLMTLQAPVAQDLRLLSAFMQLVRDLERIGDYAKDLAEIALKLFAY
TPHDCMSEIEAMSHHAQYMLATSLVALADLDQEAGPKVKELDNTVDQAYDYLYHTLAHQR
DIKGVVEPILLMALLIRHLERMADHATNIAQRVSYIVTGQRG
Download sequence
Identical sequences B0JY50
449447.MAE_52660 WP_012267636.1.4043 gi|166368007|ref|YP_001660280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]