SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368035|ref|YP_001660308.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368035|ref|YP_001660308.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 9.42e-83
Family Histidine biosynthesis enzymes 0.0000000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368035|ref|YP_001660308.1|
Sequence length 254
Comment imidazole glycerol phosphate synthase subunit HisF [Microcystis aeruginosa NIES-843]
Sequence
MLAKRILPCLDVNKGRVVKGVNFVNLQDAGDPVELARLYNQAGADELVFLDITATHEDRD
TIIDVVYRTAEQVFIPLTVGGGIQSLENIKNLLRAGADKVSINSAAVREPELLDRASDRF
GKQCIVVAIDARRRKDEHNPGWEVYVRGGRKNTGIDALLWAQEVEKRGAGELLVTSMDAD
GTQAGYDLALTKAIAERVEIPVIASGGAGNCQHIYEALTEGRAEAALLASLLHYGQLTIA
EVKNYLQNQQVPVR
Download sequence
Identical sequences B0JY78
WP_012267656.1.4043 449447.MAE_52940 gi|166368035|ref|YP_001660308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]