SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368051|ref|YP_001660324.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368051|ref|YP_001660324.1|
Domain Number 1 Region: 1-321,434-476
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-60
Family FAD-linked reductases, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368051|ref|YP_001660324.1|
Sequence length 486
Comment zeta-carotene desaturase [Microcystis aeruginosa NIES-843]
Sequence
MRVVIVGAGLAGMATAIDLVDAGCTVEILESRPFVGGKVGSWVDADGNHIEMGLHVFFGC
YYNLFELMKKVGAFQSLLLKEHTHTFINEGGKIGELDFRFAAGAPFNGLKAFFTSSQLSA
ADKIFNSLALGTSPIVRGLIDFQGAMKTIRELDSISFADWFRSHGGNDGSLKKMWNPIAY
ALGFIDTENISARCMLTIFQFFAAKTEASVLRMLEGSPHEYLHKPIINYLEARGAKISTR
RQVREILYSGEGENLQVNGMIVANGETTETITADAYVCAGDVPGVQRLIPQDWRKMPIFD
NIFRLEAVPVATVQLRFDGWVTELNDAEKRRQLQKAVGIDNLLYTHQADFSCFADLALTS
PRDYYRPGEGSLLQLVLTPGDPFIKAKNEDIAGHVLAQVHKLFPSSQELKMTWFSVVKLA
QSLYREAPGMDVYRPSQATPIANFFLAGSYTQQDYIDSMEGATLSGKQAAKAILQQAERW
KSLATV
Download sequence
Identical sequences B0JY94 I4HKI8
WP_002796087.1.4043 WP_002796087.1.50331 449447.MAE_53100 gi|166368051|ref|YP_001660324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]