SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368056|ref|YP_001660329.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368056|ref|YP_001660329.1|
Domain Number 1 Region: 32-218
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.26e-74
Family HD domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 207-422
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.55e-60
Family RelA/SpoT domain 0.0000185
Further Details:      
 
Domain Number 3 Region: 405-477
Classification Level Classification E-value
Superfamily TGS-like 4.41e-20
Family TGS domain 0.074
Further Details:      
 
Domain Number 4 Region: 681-759
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000206
Family AF1403 N-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368056|ref|YP_001660329.1|
Sequence length 765
Comment GTP pyrophosphokinase [Microcystis aeruginosa NIES-843]
Sequence
MNAITAIQPETLTVLPRATEPKKALVLPDWLKECLITYENDPQNPDIDLICRAFNFAHKL
HEGQYRKSGEPYIAHPIAVAGLLRDLGGDGAMIAAGFLHDVVEDTEVTPEEIEARFGVEV
RNLVEAVTKLSKFNFSSKTERQAENFRRMFLAMAQDIRVIVVKLADRLHNMQTLEHLNPQ
QQQRIALETREIFAPLANRLGIGRFKWELEDLCFKYLEPDAYRAVQLLVSEKRIDREARI
ETVTNTLREKLPEIGIKVLDLQGRPKHLYGIYHKMHNQGKEFEQIYDIAAVRIIVETKEE
CYRCLAIVHDQFTPIPNRFKDYIGLPKANRYQSLHTTVVGLNARPLEVQIRTLEMHHVAE
YGIAAHWKYKETGSSQTTLTAADEKFAWLRNLLDWQKDLKDGQEYMDGLKNNFFEEDIYV
FTPKGDVVALAQGATPVDFAYHIHSEVGNQMKGARINGKWSVLDAPLQNGDLVEILTSKN
SHPSLDWLNFVVTPSARNRIRQWYKKSRREENISRGRDLLEKELGKTGFDALLKSERMQS
VAKQCNYVAVDDLLAALGYGEVTLKNVVNRLQETVKNQQEILTAKNPPDVLTDSQLILPP
SPVQRALPVSKSPIAGVEGLVYRLAGCCCPLPGENITGIVAHAGEGIVIHRQGCSNVEKA
EAERLIPVSWNPIDDQGRYPTYPVNIQIEVIDRVGVLKDILSRLSDQNINVRNAGVKTNF
GKPALISLKIEVKDLQQFERCVTQIKLMSDVLNVRRISQVKSDRE
Download sequence
Identical sequences B0JY99
WP_012267671.1.4043 gi|166368056|ref|YP_001660329.1| 449447.MAE_53150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]