SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368083|ref|YP_001660356.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|166368083|ref|YP_001660356.1|
Domain Number - Region: 226-263
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00238
Family DNA primase zinc finger 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368083|ref|YP_001660356.1|
Sequence length 297
Comment transposase [Microcystis aeruginosa NIES-843]
Sequence
MKSKGFGFPRFKKKMRSFIFPALSKNFLGDGCLNFPQLGKISIRPSREYPSGFEPKQARI
IQKASGFYVSVSFQSTELVPDMTVGKTCLGIDAGIESFVATSREDLIKAPRFLLKVQSKL
KLLQRRLKHQVKGSNNWLKLQEKIARLHEKVSNTRRDWHFKLAHYLGDFADNIFVEDINF
VSWSRGIVRKQSLDSGIGSFINEILPFVVWKRGKYYLKVDKNGTSQDCPNCGAITGKKSL
SERVHRCDSCGNIEPRDTASAKVIENRGKNAVGLTVLENARGGDLTGIDRVKPGRSS
Download sequence
Identical sequences B0JYC6
449447.MAE_53420 gi|166368083|ref|YP_001660356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]