SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368115|ref|YP_001660388.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368115|ref|YP_001660388.1|
Domain Number 1 Region: 349-541
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.3e-48
Family Ppx associated domain 0.00078
Further Details:      
 
Domain Number 2 Region: 153-335
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.77e-41
Family Ppx/GppA phosphatase 0.00086
Further Details:      
 
Domain Number 3 Region: 26-149
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.18e-35
Family Ppx/GppA phosphatase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368115|ref|YP_001660388.1|
Sequence length 552
Comment exopolyphosphatase [Microcystis aeruginosa NIES-843]
Sequence
MVNISNQVIPNRGLAPQAKASDVQILAAIDIGTNSVHMVVVAIEPSLPAFTIIAREKDTV
RLGDRDRKTGKLTLVAMERAIAALKRCHDLAISLQADQIIAVATSATREATNGDEFLALI
EKEVGISVNLISGQEEARRIYLGVVSGMDFQNQAHIIIDIGGGSTELILADSQEIRFLSS
TKIGAVRLSQDLITTDPISPTELAYLRAYTRGMLERAGSEIKHHLQLGEVPRLVGTSGTI
ETLMTIHALEKLGEIPNPLNGYQLTRKDVKELVKRFATLDYHQRLAILGMSDKRAEIILA
GSIVLLEAMTMLDVDKLVLCERALREGVIVDWMLTHGLIDNRLLYQSEIRQRSVLKIAKK
YQVNLESAERIAAFSLSLFEQTQAQLHSWNQEAKDLLWAAAILHNSGLYVSHAAHHKHSY
YLIRNGELLGYTEIELEVIANIARYHRKSKPKKRHDDFMKLTEYYQYMVRHLSAILRLAV
ALDRRQIGAIKKIECKYDPEYRTLHLHLFPNNAEDDCALELWSLDYKKPVFEEEFGVKVV
ATLAFLPLNHDR
Download sequence
Identical sequences B0JYF8
gi|166368115|ref|YP_001660388.1| WP_012267718.1.4043 449447.MAE_53740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]