SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368198|ref|YP_001660471.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368198|ref|YP_001660471.1|
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.23e-74
Family Histidine biosynthesis enzymes 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368198|ref|YP_001660471.1|
Sequence length 253
Comment 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase [Microcystis aeruginosa NIES-843]
Sequence
MEVIPAIDILDGKCVRLYQGDYQQSQVFNDNPAIVAREWVNQGATRLHLVDLDGAKEGKS
VNLSTIETILNDIAIPVQVGGGLRDLETVSNLLKIGVEKAILGTVAVEKPELVSELCQSF
PGQIIVGIDARDGKVATRGWLETSEVEAIALGQDMAKRGASTIIYTDIHRDGTLSGPNLA
ALRELAESVEIPVIASGGISSLTDLLSLLSLEPLGVTGVIVGRALYTGAVNLSEAISAIG
SGRWQDVPPNFFA
Download sequence
Identical sequences B0JGL3 I4HLG5
449447.MAE_54570 gi|166368198|ref|YP_001660471.1| WP_002796216.1.4043 WP_002796216.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]