SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368207|ref|YP_001660480.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368207|ref|YP_001660480.1|
Domain Number 1 Region: 40-354,542-602
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.37e-31
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368207|ref|YP_001660480.1|
Sequence length 832
Comment hypothetical protein MAE_54660 [Microcystis aeruginosa NIES-843]
Sequence
MSQNESNVNNQDTSFAFGTDILGRYFCNTLEEAAKSNEAKPFDVVVIGSGMYGSYIASKL
YHWSKNKKQLGEEKRLKILILEAGPYIVHEHIENLPPKTGIFDENIDHPHMKSPYVCHVR
RAGMGEEFFGEVKKHSYCVGGKSLTWGKWSPRLTDEDLASWPKELRDFLYENYKEVEDET
GVSDYSDLINGTLFKGLKKFLEEKLNSPDLNHLKLKDPPVAVAANSTRSGVYSPDAFSSL
GRLLQNIRIESQYDDVPKPNDPIWKSKSIFLVPNTFVYKLETDKGSVSRIHVVDSNSQKT
SSFELLSNCEVILAGTAVESTRLVLNSFPRSDSLKENQELIGRNLMGHLFSAVTVRIKRE
ALGFLKEDVLESALYHLQGYSERFKKSYHFQFLCSSDPGFDVFTTLYKMFYDYEELVDTL
GSQDQEWVTLLIFTVSEVQGKPKAPLYTEGSNWMNLSKDQIEVFGEVKYAKPYLKWESSP
EDEEFWDEVHSTLFDFLSSLVSFGAIEYQDPNDAKKWTPEKPTQFDPYQKTEAFWNSRHE
SGTLWMGENPDESVTDLDGKLHHIQNVYCADQAIFPTVGSANPVLTGLTLCRKIADSIIK
RHISSEFVEEEDADSIIERHISSKFVEEEDFEILYRGDFKSDGWKFLESNKSGAKNFFDI
KDSLPILGAGVSDKDVKMGALCYTRKKFKNFILKLEWKAFAIEANSGIFLRRPEPKGESF
YDNLIEVQIDETAYDYKKKIYGSPLHKTGAVYDIFPAQRWATKVISPRNSEHPGYWNSCE
ITVQDNTIEVKLNDKIVSAGTFSESVNLEGFIALQCHTEVVQFRNIRIKEQP
Download sequence
Identical sequences B0JGM2
WP_012267784.1.4043 gi|166368207|ref|YP_001660480.1| 449447.MAE_54660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]