SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368230|ref|YP_001660503.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368230|ref|YP_001660503.1|
Domain Number 1 Region: 98-191
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000222
Family Multidrug resistance efflux transporter EmrE 0.017
Further Details:      
 
Domain Number 2 Region: 2-43
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000732
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368230|ref|YP_001660503.1|
Sequence length 193
Comment DMT superfamily permease [Microcystis aeruginosa NIES-843]
Sequence
MGFSPLFLVMASPVLLHEFPSKAQFLGILLVCLGAYCLNLNPREKNYLAPLKSLITNQPS
RLMIIVAFLWALTTSFDKIGAKNSSPLFFSASLYFCTALMSFPIVIVCSPNWFSKLRANL
AKLILLGGLKAVDMWCHVMAIASTVAANSVAVKQSSLLMSVGYGYFLFHEKNIKQRLFGC
IIILAGVSLLSIL
Download sequence
Identical sequences B0JGP5
449447.MAE_54890 gi|166368230|ref|YP_001660503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]