SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368233|ref|YP_001660506.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368233|ref|YP_001660506.1|
Domain Number 1 Region: 806-892,927-991,1145-1344
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-86
Family WD40-repeat 0.0000114
Further Details:      
 
Domain Number 2 Region: 697-845
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.61e-44
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 
Domain Number 3 Region: 902-1150
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.14e-33
Family DPP6 N-terminal domain-like 0.032
Further Details:      
 
Domain Number 4 Region: 43-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000142
Family RecA protein-like (ATPase-domain) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368233|ref|YP_001660506.1|
Sequence length 1385
Comment WD repeat-containing protein [Microcystis aeruginosa NIES-843]
Sequence
MINNFYKYGGKLHAHTPSYVKRFADGQLYELLKQNYFCYVFNCRQMGKSSLQAQVKIRLE
ATNAQENQCVYLSLQEMGVSQSSSENQWYRGLSKKIFRGLNLQKQANFDECWSRFSGQGS
VSSFSDFIVEVLLPLTSSNLVIFIDEIDKILELSFRDNFFGLIRAFHEKRAEYDEFNRLT
FCFLGVATPNDLIQNPLQSPFNIGRAIELRGFEFNESLVLAQGLQDVANVPEEVLREILF
WTGGQPFLTQKVCALLVESQVRIGEGQEKSFIEEFIYSSIIRNWEAQDDPLHLKYIKTRL
LAKEILTGKLLEIYRHILQNGYFTTEGNQLESELRLSGLVVKRNADLEIFNPIYREVFSL
EWVQKQLDNLRPYAVALNAWLASEKNNVYLLDETETARADIWREGKFLTREDEEFIRDSK
LAQKDKDSAQKIEAEREAKKILEKAKKKAQKALTGSIIASALIIAGTLVFAIIQTTKAER
ASQEANQSMQALTNIKKERDKIGQEVIRANDRLSQVSAERRQIELNARQRLAVAQGNLKR
LETARNQAQQQVTQFQRQKTILERERQIILAQKLEAESRTRKSQGELQEIKGSLQVNRQR
LEEVNRNLQKAEQAQQLTIKLTQLEQRGINISRRFENGNEGQISLLIEALEIGQELQNVA
KSGFKNEYSAPGFLLTIRTIINEIQERNRLVFQAKIITLSPNGQYIVTESKDGAIHLWDL
KGNLLTEFKGHQEDVETVAFSPDGKYLVTGSEDDTARLWDLKGNLLKEFKGHQGDVETVA
FSPDGKYLATGSMDDTARLWDLNGNLIAELKGHQNNVVSVNFSPDGKYLATGSKDNTLRL
WDLKGNLLTEFKGHQKDEDVESVAFSPNGKYLATGSEDENDTARLWDIKGNLVKEFKKNK
RIVFSPDSKYLVTRSFEAELWDIKRNVITELNGHQRGVIDVSFSPDGKYLATLDYYGAVR
LWNLKGNLIIQFKVHFDQGKRLEFSPDGQYLMSIASTGVIDKNDTLFVWDLPKDLITQLS
CLKDNERIQPCIASNVLIDIAKDCYESTESIAFQAIYCSIHHISSVSFSPNGKYLATGPK
RSAIAQIWDLQGKLLVNLGKRDLKFGATVADFDASVAFSPNSQYLATGSEDGIARLWNLQ
GKLLIEFKGHRKNLDINTIAFSPDDQYLATGSQDNTARLWDLKGNLLAQFKGHQQGVSSV
AFSPDGKYLATGSGDNTARLWDLKGNLLTKFKGHQQGVSSVAFSPDGKYLATGSGDNTAR
LWDLKGNLLTKFKGHQEGVSSVAFSPDGKYLATGSWDNTARLWDLQGNILAEFKGHQEGV
KSVAFSPDGKYLATGSMDATARLWLIEDLDALLVRGCHWLKDYFVSHPQDLQELPVCQQA
LKTSR
Download sequence
Identical sequences B0JGP8
449447.MAE_54920 gi|166368233|ref|YP_001660506.1| WP_012267806.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]