SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368239|ref|YP_001660512.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368239|ref|YP_001660512.1|
Domain Number 1 Region: 12-72,103-268
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.42e-41
Family GidA-like 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|166368239|ref|YP_001660512.1|
Domain Number - Region: 457-565
Classification Level Classification E-value
Superfamily PHP domain-like 0.0942
Family PHP domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368239|ref|YP_001660512.1|
Sequence length 635
Comment tRNA uridine 5-carboxymethylaminomethyl modification protein GidA [Microcystis aeruginosa NIES-843]
Sequence
MTFSSAADFQDEFDVIVVGAGHSGCEAALACARLGCRTLLLTLNLDKIAWQPCNPAVGGP
AKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAAVMKGIVET
QANLVIREAMATDLILGANEQVLGVETYFGTCFAAKAVILTTGTFLGGKIWIGGKSMAAG
RAGEFAAVGLTETLNRLGFETGRLKTGTPARVDKRSVDYSRMEPQPPDDEVRWFSFDPEV
WIEREQMNCHLTRTTAATHQLIRDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESH
QIFIEPEGRDIPELYIQGFSTGLPENVQLAMLRTLPGLENCVMLRAAYAVEYDYLPATQC
YPTLMTKKIEGLFCAGQINGTTGYEEAAAQGLVAGINAARFALGKELIVFPREESYLGTL
VDDLCTKDLREPYRMLTSRSEYRLVLRSDNADQRLTPLGREIGLIDNRRWQLFQSKQANI
IAEKERLHETRIKERDQVAIAIVKDTEQKIKGSLSLADLLRRPSLHYLDLDRYGLGNPDI
NLAEREGVEIEIKYSGYLKRQQNQIDQISRHSNRHLSPDIDYMKIETLSMESREKLTKIK
PATIGQASRIGGVNPADINALLVYLEMRQMSAVKS
Download sequence
Identical sequences A0A1V4BLY6 B0JGQ4
gi|166368239|ref|YP_001660512.1| WP_012267812.1.4043 WP_012267812.1.79847 449447.MAE_54980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]