SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368255|ref|YP_001660528.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368255|ref|YP_001660528.1|
Domain Number 1 Region: 68-186
Classification Level Classification E-value
Superfamily beta-Roll 4.84e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 160-186,214-293
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000903
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 
Domain Number 3 Region: 301-419
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000458
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368255|ref|YP_001660528.1|
Sequence length 502
Comment hemolysin-type calcium-binding protein [Microcystis aeruginosa NIES-843]
Sequence
MPLITGDIFNNIITPLFASLGVIGWYSGLGGDDIIFGYDGDDFLDGGNGNDFLDGDDGSD
TLHGGLGNDFLDGGDGNDTLNGGLGDDTLYGGLGNDTSDGGDGNDLIIGNDGDDLLLGNA
GNDFLIGNAGNDSLDGGLGDDFLNGGDGNDILNGGVGVDSMDGGNGDDLYGVDNSGDIVR
ELLNTAPGGTADTVLSSVTYSLAPGTLGTQGFGIENLILTGSANINATGNGANNILVGNI
GNNVLDGGLGNDTLNGGDGNDILNGGVGVDSMDGGNGDDLYGVDNSGDIVRELLNTAPGG
TADTVLSSVTYSLAPGTLGTQGFGIENLILTGSANINATGNGTNNILVGNIGNNVLGGGL
GNDALNGSSGQDTLVDFAGSDLFWLDEIGLANRDLIFGFSVLDDRIVLADRLDSSLVGFI
SPGIKGLGFTGGPLPGNPLNPASFFSGAGFTGGSLGAPSGIYVNTTNGDIWYNDSTVLGS
SLIANVGAGAAAGMTNSHFVYG
Download sequence
Identical sequences B0JGS0
gi|166368255|ref|YP_001660528.1| WP_012267824.1.4043 449447.MAE_55140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]