SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368404|ref|YP_001660677.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368404|ref|YP_001660677.1|
Domain Number 1 Region: 1-585
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.7e-189
Family Prokaryotic type I DNA topoisomerase 0.0000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|166368404|ref|YP_001660677.1|
Sequence length 878
Comment DNA topoisomerase I [Microcystis aeruginosa NIES-843]
Sequence
MSTLVIVESPTKARTISNYLPSGYRVQASMGHIRDLPASAEEIPPAHKDKSWANLGVDVE
NDFDPLYVVPKTKSKVVKELKEALKGASELILATDEDREGESISWHLLQVLNPKIPTKRM
VFHEITKEAIQAALKNCRSIDENLVHAQETRRILDRLYGYTLSPLLWKKISKGLSAGRVQ
SVAVRLLVQRERERRAFKTANYWDLKATLEKDKNQFESKLVTLNGQKVANGSDFDADTGR
LLPGRQVTLLDQATAAALKERIEDKIWRVSHTEEKPTTRKPSPPFTTSTLQQEANRKLGI
SARDTMRIAQNLYEQGYITYMRTDSVHLSDQAITAARNCVEQMYGKNYLSPQPRQYTTKS
KGAQEAHEAIRPAGSSFRLPRETGLSGLEFALYDLIWKRTVASQMADARITQIAVNIQVE
NAGFRSSGKRIDFPGFFRAYVEGSDDPEAAIDDQEIILPALSVGDTPNCRQLEAISHDTQ
PPARYSEASLVKTLESEGIGRPSTYATILGTIIDRGYAQMRNKTLIPTFTAFAVVSLLEN
HFPDLVDPKFTSKMEETLDDIATGSAQWLPYLDRFYRGEKGLESQVKERESQINSSTAKS
VILEDLQATIKIGKYGPYLEVSRGDQILTASIPADLTPADLNPEQVETLLRQKTEGPDKL
GLHPDSGEPIYLLVGSYGPYVQLGDVSDDNPKPKRASLPKGVKPEDVTLEQAVGLLALPR
LLGTHPLTGGKIKASLGRFGPYIVQEQGKEKEYRSLKAGDDVLTITLDRALALLAEPKKT
RSARGSTKPPLKELGKHPDDGESVGLYEGPYGVYIKHGKTNAKIPEGETAETLTLEQALV
ALAAKTTTAKKTTTKKTTSSTTKKTTSPGSKTSKSKTV
Download sequence
Identical sequences B0JHS3 I4HMJ2
gi|166368404|ref|YP_001660677.1| WP_002796370.1.4043 WP_002796370.1.50331 449447.MAE_56630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]