SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368416|ref|YP_001660689.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368416|ref|YP_001660689.1|
Domain Number 1 Region: 274-431
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000424
Family HD domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166368416|ref|YP_001660689.1|
Sequence length 457
Comment putative sensor protein [Microcystis aeruginosa NIES-843]
Sequence
MTVESSLQQLKRASSGRLPSSYGVYFKNTLVALCHALEDHILQTSSPDSTNKPLVLVTFQ
QGKWYLQEAERYLDIARSSRHIAIAAVADSGFSEHKTGSLENVSLVNLDNSDSLVNEWNL
IILSPDYASMVLCHELSPEEYRSDSQPQIDTERKFYGLWTFDRDLVEKAARILIERLHPY
NPSLAADLSRQQQEISQNINPIPTDLTGVVSRIVTYLQTSQQQLVTVSRQTRELSDLEGQ
ASRLNKNLAANKLQAFLRMAQKVDERDIDNPLASLQVAALAEMLGQLLDLPTLRLRRLRL
AGLLYRIGLAEAPIEVFRQRASQLEGANALFWRDRSVLGAQLLATMPELAPIQQIIYHEF
EYWDGSGVPNGLKGEEISLESRILGLSAYFQELTQPRGDRLALDLGEALERCQNYSGIRF
DPALVEKLSSVIRLCEMGWMQLPDRPSQVPAVWLESV
Download sequence
Identical sequences A0A1V4BZU6 B0JHT5 I4HML6
gi|166368416|ref|YP_001660689.1| WP_002796380.1.4043 WP_002796380.1.50331 WP_002796380.1.79847 449447.MAE_56750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]