SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166368474|ref|YP_001660747.1| from Microcystis aeruginosa NIES-843

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166368474|ref|YP_001660747.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Ribosomal protein L14 4.84e-52
Family Ribosomal protein L14 0.00000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166368474|ref|YP_001660747.1|
Sequence length 122
Comment 50S ribosomal protein L14 [Microcystis aeruginosa NIES-843]
Sequence
MIQQQTYLNVADNSGARKLMCLRVLGTGNCTYGGIGDKIIAVVKDAIPNMPVKKSDVVTA
VIVRTRQTVRRDSGMSIRFDDNAAVIINNDGNPKGTRVFGPVARELRDKNYTKIVSLAPE
VL
Download sequence
Identical sequences A0A0A1VTH4 A0A0F6RJ21 A0A0K1RWI5 A0A139GJ34 A0A1E4Q8K4 A0A1V4BWS8 A0A1X9L8F6 A0A2H6BME2 A0A2H6L711 A8YFZ0 B0JHZ3 I4FA15 I4FXX9 I4G8U4 I4GJ78 I4GQ86 I4H7D0 I4HMW8 I4HWL0 I4I8T2 I4IMU9 L7EAC6 L8NM13 S3J0Q6
WP_002732358.1.10452 WP_002732358.1.13945 WP_002732358.1.15998 WP_002732358.1.20667 WP_002732358.1.23084 WP_002732358.1.24258 WP_002732358.1.39664 WP_002732358.1.4043 WP_002732358.1.42333 WP_002732358.1.43950 WP_002732358.1.43975 WP_002732358.1.50331 WP_002732358.1.50673 WP_002732358.1.52201 WP_002732358.1.5315 WP_002732358.1.62741 WP_002732358.1.6707 WP_002732358.1.77316 WP_002732358.1.7764 WP_002732358.1.79847 WP_002732358.1.86711 WP_002732358.1.88161 WP_002732358.1.92877 WP_002732358.1.98808 gi|166368474|ref|YP_001660747.1| 449447.MAE_57330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]